PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA57G00269
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 483aa    MW: 55423.2 Da    PI: 4.6272
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA57G00269genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.61.6e-192572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll d+v+++G g+W+++ ++ g+ R++k+c++rw ++l
       AA57G00269 25 KGPWTAEEDQLLTDYVEKHGEGNWNAVQQHSGLSRCGKSCRLRWVNHL 72
                     79*******************************************996 PP

2Myb_DNA-binding45.32e-1478121146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+e+ ++ ++++G++ W++ a ++  gRt++++k++w++
       AA57G00269  78 KGAFTEEEEEQVIRMHALYGNK-WARMAVEIR-GRTDNEIKNFWNT 121
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.2522076IPR017930Myb domain
SuperFamilySSF466895.24E-2923119IPR009057Homeodomain-like
SMARTSM007171.3E-162474IPR001005SANT/Myb domain
PfamPF002491.5E-172572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-252679IPR009057Homeodomain-like
CDDcd001676.52E-132772No hitNo description
PROSITE profilePS5129418.0777127IPR017930Myb domain
SMARTSM007176.0E-1577125IPR001005SANT/Myb domain
PfamPF002493.2E-1378121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2280125IPR009057Homeodomain-like
CDDcd001675.41E-1180123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MWKDEGDPGL GDECGSPGAD KSFIKGPWTA EEDQLLTDYV EKHGEGNWNA VQQHSGLSRC  60
GKSCRLRWVN HLRPDLKKGA FTEEEEEQVI RMHALYGNKW ARMAVEIRGR TDNEIKNFWN  120
TRLKRLQRLG LPMYPDGIRN QAMLAAQTGQ NPDTSAANGQ EQEDELMLPL LDFKLLQHHK  180
RLKHYEEMIN SIPMPTKFRP LTIIAPNVYI QTTPPNMEPG TTFPVPGSID IAEQYSQLWN  240
SPSSYMPMHP SSSYRQISPE QPSSQVFGQR DNHFLGYDKY FSSSMSLNQE SEKLELPSIQ  300
RFDPQEVPDE WGIHPNESMS IFDKLEPIPT SESMLDFDES MPALESYDTL HQSSFVDQRP  360
YDFDSGFYDE TFGLHHNYES NGGKVANYTH SESPQIEPFS LEDTKMAYNT PFEYPQIQSS  420
APVNAAVTRT DFPYTGHNSE RMEPEPSSSI QSDNWDGVGS ECSDERHVSE EDWFRRLVRK  480
DRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27231255106B-MYB
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00279DAPTransfer from AT2G26960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91982138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.17e-89myb domain protein 81